Links to multiple antibodies on this page for Neuroglobin: mNgb-fuse-Linker(test) mNgb-fuse-NoLinker(test) mNgb-pepA(test) mNgb-pepB(test) mNgb-pepC(test) mNgb-pepD(test) mNgb-pepE(test) Antibody Name/Abbreviation: mNgb-fuse-Linker(test) CBI Antibody Core Code: A0797 "Lot" Number: 1 Position: 88(fuse with linker|1-21|43-59|90-98|124-136|144-151) % Identical Homology of Target to Mouse Protein: 38% (NP_071859.1| neuroglobin) Molecular Weight of fusion protein: 23.68 KDa Target sequence used to make this antibody: MERPESELIRQSWRVVSRSPLGGGGSQYNGRQFSSPEDCL
SSPGGGGSTSLGRKHRAGGGGSDFTPATRTAWSRLGGGGS
MSRGWDGE
Antibody Name/Abbreviation: mNgb-fuse-NoLinker(test) CBI Antibody Core Code: A0798 "Lot" Number: 1 Position: 68(fuse without linker 1-21|43-59|90-98|124-136|144-151) % Identical Homology of Target to Mouse Protein: 45% (NP_071859.1| neuroglobin) Molecular Weight of fusion protein: 21.48 KDa Target sequence used to make this antibody: MERPESELIRQSWRVVSRSPLQYNGRQFSSPEDCLSSPTS
LGRKHRADFTPATRTAWSRLMSRGWDGE
Antibody Name/Abbreviation: mNgb-pepA(test) CBI Antibody Core Code: A0799 "Lot" Number: 1 Position: 21(1-21) % Identical Homology of Target to Mouse Protein: 100% (NP_071859.1| neuroglobin) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: MERPESELIRQSWRVVSRSPL
Antibody Name/Abbreviation: mNgb-pepB(test) CBI Antibody Core Code: A0800 "Lot" Number: 1 Position: 16(43-59) % Identical Homology of Target to Mouse Protein: 100% (NP_071859.1| neuroglobin) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: QYNGRQFSSPEDCLSSP
Antibody Name/Abbreviation: mNgb-pepC(test) CBI Antibody Core Code: A0801 "Lot" Number: 1 Position: 9(90-98) % Identical Homology of Target to Mouse Protein: 100% Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: TSLGRKHRA
Antibody Name/Abbreviation: mNgb-pepD(test) CBI Antibody Core Code: A0802 "Lot" Number: 1 Position: 13(124-136) % Identical Homology of Target to Mouse Protein: 100% (NP_071859.1| neuroglobin) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: DFTPATRTAWSRL
Antibody Name/Abbreviation: mNgb-pepE(test) CBI Antibody Core Code: A0803 "Lot" Number: 1 Position: 8(144-151) % Identical Homology of Target to Mouse Protein: 100% Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: MSRGWDGE
| Sequence Name: Neuroglobin Full name: Neuroglobin UniGene Number: N.A. Accession Number: NP_071859 Source organism: mouse ( Mus musculus ) Full length size (aa): 151 NCBI information page: click here Full length sequence: MERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFS
SPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVG
VRLSSFSTVGESLLYMLEKCLGPDFTPATRTAWSRLYGAVVQAMSRGWDG
E
|