mouse ( Mus musculus )
mSox11

Western result: +/-

GST GST-mSox11 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: mSox11
CBI Antibody Core Code: A0301
"Lot" Number: 2 Position: 100(112-211)
% Identical Homology of Target to Mouse Protein: 45% (XP_356578.1| RIKEN cDNA 6230403H02)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
DYPDYKYRPRKKPKTDPAAKPSAGQSPDKSAAGAKTAKGP
GKKCAKLKAPAGKAGAGKAVQPGDCGAGKAAKCVFLDDDD
DEEDDDDELQLRPKPDADDD

Other western:
Code: A0301
Lot: 1

Western result: +/-

GST GST-mSox11 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Sequence Name: mSox11
Full name: SRY-box containing gene 11; SRY-box containing gene II (Sox II)
UniGene Number: N.A.
Accession Number: NM_009234
Source organism: mouse ( Mus musculus )
Full length size (aa): 395
NCBI information page: click here

Full length sequence:
MVQQAESSEAESNLPRDALDTEEGEFMACSPVALDESDPDWCKTASGHIK
RPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIR
EAGRLRLKHMADYPDYKYRPRKKPKTDPAAKPSAGQSPDKSAAGAKTAKG
PGKKCAKLKAPAGKAGAGKAVQPGDCGAGKAAKCVFLDDDDDEEDDDDEL
QLRPKPDADDDDDEPAHSHLLPPPAQQQPPQLLRRYSVAKVPASPTLSSA
AESPEGASLYDEVRAGGRLYYSFKNITKQEAPPAPPALSPASSRCVSTSS
SSGSSSGSGAEDADDLMFDLSLNFSQGAHSACEQPLGAGAAGNLSLSLVD
KDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWLEANFSDLVFTY