Return to CBI Antibody Core Home Page
  Return to mouse list
    Return to mouse ( Mus musculus ) list


mouse ( Mus musculus )
mCu/ZnSOD1-N



Western result: +
GST
GST-mCu/ZnSOD1-N
(fragment)

38 kDa (recombinant)
The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: mCu/ZnSOD1-N
CBI Antibody Core Code: A0255

"Lot" Number: 3 Position: 100(1-100)
% Identical Homology of Target to Mouse Protein: 100% (NP_035564.1| superoxide dismutase 1, soluble; Cu(2+)-Zn2+ superoxide dismutase)
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
MAMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLT
EGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEER
HVGDLGNVTAGKDGVANVSI






Sequence Name: mCu/ZnSOD1-N
Full name: Cu/Zn superoxide dismutase
UniGene Number: N.A.
Accession Number: P08228
Source organism: mouse ( Mus musculus )
Full length size (aa): 154
NCBI information page: click here

Full length sequence:
MAMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQ
YGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSI
EDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVI
GIAQ





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.