Sulfolobus solfataricus
aMBF1-hand pick

Western result: +/-

GST GST-aMBF1-SeqPick pick (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: aMBF1-SeqPick pick
CBI Antibody Core Code: A0818
"Lot" Number: 1 Position: 100(48-147)
% Identical Homology of Target to Mouse Protein: 25% (NP_067494.1| endothelial differentiation-related factor 1; hypothetical protein 1-9)
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
KADSKKSETRKKATLKPPKMENAELEIVTDYYKIIKTARE
QLGISQQQLAQKLKVSENIVKRFESGKLKPTISQARQLEK
ILGIKLVTPLENNEESEKEF

Sequence Name: aMBF1-hand pick
Full name: SSO0270; Multiprotein Bridging Factor (MBP-like), putative (MBP-like)
UniGene Number: N.A.
Accession Number: 13813408; AAK40608
Source organism: Sulfolobus solfataricus
Full length size (aa): 165
NCBI information page:

Full length sequence:
MQANSEEYCELCGSQIRGKGITVSYEGSIITVCNSCYDRIRKHAVIVKAD
SKKSETRKKATLKPPKMENAELEIVTDYYKIIKTAREQLGISQQQLAQKL
KVSENIVKRFESGKLKPTISQARQLEKILGIKLVTPLENNEESEKEFDDT
GLTLGDVVNIKEGKK