pig ( Sus scrofa )
Porcine CAT-1

Western result: +

control Porcine CAT-1 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: Porcine CAT-1
CBI Antibody Core Code: A0563
"Lot" Number: 1 Position: 20(130-149)
% Identical Homology of Target to Mouse Protein: 80% (NP_031539.1| solute carrier family 7 (cationic amino acid transporter, y+ system), member 1; amino acid transporter, cationic 1)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
EASLAADQARTPDGNLDHCK

Sequence Name: Porcine CAT-1
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: pig ( Sus scrofa )
Full length size (aa): 149
NCBI information page:

Full length sequence:
LSPKNTEPSKFSGLIVNISTSLIALLILTFCMAAVLGKAALVQGQLWAVF
VLMGSAFLCLVVTAIIWRQPESKTKLSFKVPFLPILPVLSIFVNVYLMMQ
LDQGTWVRFAVWMLIGFFIYFGYGLWHSEEASLAADQARTPDGNLDHCK