Return to CBI Antibody Core Home Page
  Return to others list
    Return to nuclear polyhedrosis virus (A. Californica) ( Autographa californica ) list


nuclear polyhedrosis virus (A. Californica) ( Autographa californica )
MNPV-v-ub


Antibody Name/Abbreviation: MNPV-v-ub
CBI Antibody Core Code: A0328

"Lot" Number: 1 Position: 43(35-77)
% Identical Homology of Target to Mouse Protein: 83% (NP_035794.1| ubiquitin B)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
GVPVDQQRLIFAGKQLEDSKTMADYNIQKESTLHMVLRLR
GGY






Sequence Name: MNPV-v-ub
Full name: A.californica nuclear polyhedrosis virus ubiquitin-like protein gene
UniGene Number: N.A.
Accession Number: M30305
Source organism: nuclear polyhedrosis virus (A. Californica) ( Autographa californica )
Full length size (aa): 77
NCBI information page: click here

Full length sequence:
MQIFIKTLTGKTITAETEPEETVADLKQKIADKEGVPVDQQRLIFAGKQL
EDSKTMADYNIQKESTLHMVLRLRGGY





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.