Return to CBI Antibody Core Home Page
  Return to biothreat/emerging pathogens list
    Return to SARS list


SARS
SARS-Unknown5


Antibody Name/Abbreviation: SARS-Unknown5 (Sunk5)
CBI Antibody Core Code: A0078

"Lot" Number: 2 Position: 20(23-42)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
TITRMEDAMGQGQNSADPKV






Sequence Name: SARS-Unknown5
Full name:
UniGene Number: N.A.
Accession Number: NC004718 (w)
Source organism: SARS
Full length size (aa): 98
NCBI information page: click here

Sequence Notes: SARS-Sunk5

Full length sequence:
MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLG
SQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.