West Nile Virus (WNV)
WNV-preM

Western result: +

GST GST-WNV-preM (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: WNV-preM
CBI Antibody Core Code: A0098
"Lot" Number: 1 Position: 92(1-92)
% Identical Homology of Target to Mouse Protein: 29% (NP_032019.1| fibrillin 1; tight skin)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
VTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMD
VGYMCDDTITYECPVLSAGNDPEDIDCWCTKSAVYVRYGR
CTKTRHSRRSRR

Sequence Name: WNV-preM
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: West Nile Virus (WNV)
Full length size (aa): 92
NCBI information page:

Full length sequence:
VTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRAMDVGYMCDDTIT
YECPVLSAGNDPEDIDCWCTKSAVYVRYGRCTKTRHSRRSRR