Links to multiple antibodies on this page for pumilio: Macpum Macpum Antibody Name/Abbreviation: Macpum CBI Antibody Core Code: A1028b "Lot" Number: 1 Position: 20 (55-74) % Identical Homology of Target to Mouse Protein: 85% (NP_109648.1| pumilio 2) Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: LQDNVLKCVKDQNGNHVVQK
Antibody Name/Abbreviation: Macpum CBI Antibody Core Code: A1028a "Lot" Number: 2 Position: 100 (42-141) % Identical Homology of Target to Mouse Protein: 78% (NP_109647.1| pumilio 1) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: SLPTEQQVEIVSELQDNVLKCVKDQNGNHVVQKCIECVDP
AHLNFIVEAFKGQVVALSTHPYGCRVIQRILEHCTPAQTQ
PVLEELHQNTEQLVQDQYGN
| | Sequence Name: pumilio Full name: pumilio UniGene Number: N.A. Accession Number: N.A. Source organism: marine platyhelminth ( Macrostomum sp. ) Full length size (aa): 141 NCBI information page: Full length sequence: SKVFRVRHTGAEADPGAEGSRPSAVSALQMYGCRVIQKALESLPTEQQVE
IVSELQDNVLKCVKDQNGNHVVQKCIECVDPAHLNFIVEAFKGQVVALST
HPYGCRVIQRILEHCTPAQTQPVLEELHQNTEQLVQDQYGN
|