| Western result: + | | GST
 | GST-EVM138 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: EVM138 CBI Antibody Core Code: A1165 "Lot" Number: 1 Position: 91 (31-121) % Identical Homology of Target to Mouse Protein: 29% (NP_034711.1| CD47 antigen; integrin-associated protein; Rh-related antigen) Molecular Weight of fusion protein: 24.01 KDa Target sequence used to make this antibody: TIIIPCTIDNPTKYIRWKLDNHDILTYNKTSKTTILSKWH
TSARLHSLSDNDVSLIMEYKDILPGTYTCGDNTGIKSTVK
LVQCHTNWFND
| | Sequence Name: EVM138 Full name: EVM138 UniGene Number: N.A. Accession Number: AAM92443 Source organism: ECTV (ectromelia virus Moscow strain) Full length size (aa): 277 NCBI information page: Full length sequence: MLRVRISLIYLYTLVVITTTKTIEYTACNDTIIIPCTIDNPTKYIRWKLD
NHDILTYNKTSKTTILSKWHTSARLHSLSDNDVSLIMEYKDILPGTYTCG
DNTGIKSTVKLVQCHTNWFNDYQTTLMFIFTGITLFLLFLEIAYTSISVV
FSTNLGILQVFGCVIAMIELCGAFLFYPSMFTLRHIIGLLMITLPSIFLI
ITKVFSFWLLCKLSCAVHLIIYYQLAGYILTVLGLGLSLKECVDGTLLLS
GLGTIMVSEHFSLLFLVYFPSTQRDYY
|