Links to multiple antibodies on this page for cj1190c: cetA cetA Western result: + | | GST
 | GST-cetA A1172a (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: cetA CBI Antibody Core Code: A1172a "Lot" Number: 1 Position: 100 (355-454) % Identical Homology of Target to Mouse Protein: 34% (XP_146948.4| unc13 homolog 3) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: SVVKIDHILYKSNIYLNLNGAQNFNLESVDPISNLCQDER
AQGVINELSSETELNLAKEFIKDNAKKAIEESSQDYIDQK
AYDAIVNDIKSLEQRSAEIL
Antibody Name/Abbreviation: cetA CBI Antibody Core Code: A1172b "Lot" Number: 1 Position: 20 (161-180) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of fusion protein: 32.2 KDa Target sequence used to make this antibody: LSLGNQNKDMSQISSSLNQD
| | Sequence Name: cj1190c Full name: UniGene Number: N.A. Accession Number: N.A. Source organism: Campylobacteriosis (C. jejuni) ( Campylobacter jejuni ) Full length size (aa): 459 NCBI information page: Full length sequence: MVKNGLLLTIFLSVIGVLGVIFIHIFVGAIIFVLIAVLMIYLLRQHKDEQ
IMIDKLLVLCRELKEGNFDNRIIYVKTKSKKLAEIADNLNNTIDGLEAYL
REINTSISCSQKGEFYRKALPEGLKGIFAHNIEFINKALANIEVTARSTF
KNALSRTLMDLSLGNQNKDMSQISSSLNQDISMMKNVYDTVDAISHTATE
NGSEVDSLQSAMGSLMDVVNSSKETVQTFVANSQNITSVVEVIRDIADQT
NLLALNAAIEAARAGEHGRGFAVVADEVRKLAERTQRSTSEISIAIQTMQ
QDFVNIQSGSEQVFNIVSESEERINKFSQAFKRLEENSSALGVNFGSFAK
RLILSVVKIDHILYKSNIYLNLNGAQNFNLESVDPISNLCQDERAQGVIN
ELSSETELNLAKEFIKDNAKKAIEESSQDYIDQKAYDAIVNDIKSLEQRS
AEILAKLKI
|