| Western result: + | | | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: Rho CBI Antibody Core Code: A1184 "Lot" Number: 1 Position: 20 (1-20) % Identical Homology of Target to Mouse Protein: 95% (NP_663358.1| rhodopsin; L opsin; LWS opsin; Red Opsin; Rod Opsin; Long Wavelength Sensitive opsin; opsin 2) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: MNGTEGPNFYVPFSNKTGVV
| | Sequence Name: Rhodopsin Full name: UniGene Number: N.A. Accession Number: 0811197A Source organism: Cow (Bovine) ( Bos taurus ) Full length size (aa): 348 NCBI information page: Full length sequence: MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIML
GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLH
GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGE
NHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNN
ESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEV
TRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV
YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA
|