Return to CBI Antibody Core Home Page
  Return to other mammals list
    Return to Cow (Bovine) ( Bos taurus ) list


Cow (Bovine) ( Bos taurus )
IL-8


Antibody Name/Abbreviation: IL-8
CBI Antibody Core Code: A0430

"Lot" Number: 1 Position: FL56
% Identical Homology of Target to Mouse Protein: 51% (NP_032202.1| chemokine (C-X-C motif) ligand 1; GRO1 oncogene)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
PKFIKELRVIESGPHCENSEIIVKLTNGNEVCLNPKEKWV
QKVVQVFVKRAEKQDP






Sequence Name: IL-8
Full name: interleukin-8
UniGene Number: N.A.
Accession Number: AF061521
Source organism: Cow (Bovine) ( Bos taurus )
Full length size (aa): 56
NCBI information page: click here

Full length sequence:
PKFIKELRVIESGPHCENSEIIVKLTNGNEVCLNPKEKWVQKVVQVFVKR
AEKQDP





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.