| Antibody Name/Abbreviation: IL-8 CBI Antibody Core Code: A0430 "Lot" Number: 1 Position: FL56 % Identical Homology of Target to Mouse Protein: 51% (NP_032202.1| chemokine (C-X-C motif) ligand 1; GRO1 oncogene) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: PKFIKELRVIESGPHCENSEIIVKLTNGNEVCLNPKEKWV
QKVVQVFVKRAEKQDP
| | Sequence Name: IL-8 Full name: interleukin-8 UniGene Number: N.A. Accession Number: AF061521 Source organism: Cow (Bovine) ( Bos taurus ) Full length size (aa): 56 NCBI information page: click here Full length sequence: PKFIKELRVIESGPHCENSEIIVKLTNGNEVCLNPKEKWVQKVVQVFVKR
AEKQDP
|