Cow (Bovine) ( Bos taurus )
bIL-6

Western result: +

GST GST-bIL-6 (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: bIL-6
CBI Antibody Core Code: A0958
"Lot" Number: 1 Position: 100( 62-161)
% Identical Homology of Target to Mouse Protein: 44% (NP_112445.1| interleukin 6)
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
DKISAMRKEICEKNDECESSKETLAENKLNLPKMEEKDGC
FQSGFNQAICLIRTTAGLLEYQIYLDYLQNEYEGNQENVR
DLRKNIRTLIQILKQKIADL

Sequence Name: bIL-6
Full name: Interleukin 6
UniGene Number: N.A.
Accession Number: NP_776348
Source organism: Cow (Bovine) ( Bos taurus )
Full length size (aa): 208
NCBI information page:

Full length sequence:
MNSRFTSAFTPFAVSLGLLLVMTSAFPTPGPLGEDFKNDTTPGRLLLTTP
EKTEALIKRMVDKISAMRKEICEKNDECESSKETLAENKLNLPKMEEKDG
CFQSGFNQAICLIRTTAGLLEYQIYLDYLQNEYEGNQENVRDLRKNIRTL
IQILKQKIADLITTPATNTDLLEKMQSSNEWVKNAKIILILRNLENFLQF
SLRAIRMK