Cow (Bovine) ( Bos taurus )
bIL-17

Western result: +

control bIL-17 (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: bIL-17
CBI Antibody Core Code: A0961
"Lot" Number: 1 Position: 20 (42-61)
% Identical Homology of Target to Mouse Protein: 76% (NP_034682.1| interleukin 17)
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
RSTNSRRPTDYHKRSTSPWT

Sequence Name: bIL-17
Full name: Interleukin 17 or CTLA8
UniGene Number: N.A.
Accession Number: AAL08013.1
Source organism: Cow (Bovine) ( Bos taurus )
Full length size (aa): 141
NCBI information page:

Full length sequence:
LLLSLVALVKAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPT
DYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVT
IQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA