Yersiniosis ( Yersinia enterocolitica )
YmoA

Western result: +

control YmoA A1224b (fragment)

32.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: YmoA
CBI Antibody Core Code: A1224b
"Lot" Number: 1 Position: 20 (19-38)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
LERVIEKNKYELSDDELELF

Antibody Name/Abbreviation: YmoA
CBI Antibody Core Code: A1224a
"Lot" Number: 1 Position: 67 (1-67)
% Identical Homology of Target to Mouse Protein: 35% (XP_355549.2| similar to hypothetical protein FLJ10884)
Molecular Weight of fusion protein: 21.37 KDa

Target sequence used to make this antibody:
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYS
AADHRLAELTMNKLYDKIPPTVWQHVK

Sequence Name: YmoA
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: Yersiniosis ( Yersinia enterocolitica )
Full length size (aa): 67
NCBI information page:

Full length sequence:
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELT
MNKLYDKIPPTVWQHVK