fruit fly ( Drosophila melanogaster )
Mub

Western result: +

control Mub-pep2 A1008b (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: Mub-pep2
CBI Antibody Core Code: A1008b
"Lot" Number: 1 Position: 20 (323-342)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
IRISNCEEREGGNTDRTITI

Western result: +

control Mub-pep1 A1008a (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: Mub-pep1
CBI Antibody Core Code: A1008a
"Lot" Number: 2 Position: 20 (276-295)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
SQLRTANPANRAQQQQHEMT

Sequence Name: Mub
Full name: mushroom-body expressed
UniGene Number: N.A.
Accession Number: P91632
Source organism: fruit fly ( Drosophila melanogaster )
Full length size (aa): 386
NCBI information page:

Full length sequence:
MEDNNTSSSAGGASIKHEDPSVTLTIRLIMQGKEVGSIIGKKGEIVNRFR
EESGAKINISDGSCPERIVTVSGTTNAIFSAFTLITKKFEEWCSQFNDVG
KVGKTQIPIRLIVPASQCGSLIGKSGSKIKEIRQTTGCSIQVASEMLPNS
TERAVTLSGSAEQITQCIYQICLVMLESPPRGATIPYRPKPQVTGPVILA
NGQAFTIQGNYAVPTQEVAKNPLASLAALGLAGMNPASTGGINHTGELSA
SAARCQTDFQSNLGSAPAALAALAGSQLRTANPANRAQQQQHEMTVSNDL
IGCIIGKGGTKIAEIRQISGAMIRISNCEEREGGNTDRTITISGNPDSVA
LAQYLINMRISMETAGLPIPGYHYIAPSAIVKTPIH