fruit fly ( Drosophila melanogaster )
morgue

Western result: +

GST GST-morgue (111-210) A1047 (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: morgue (111-210)
CBI Antibody Core Code: A1047
"Lot" Number: 1 Position: 100 (111-210)
% Identical Homology of Target to Mouse Protein: 33% (NP_598680.2| myeloid/lymphoid or mixed-lineage leukemia translocated to 2 homolog; robotic)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
TENDVDIMGFEDLEDPQPAAVPQHPNPQPPMEPQDQQPAQ
PVIDLPQPVPEAAAPRRESPERDFEHERAINPFLLPIKRP
RATAPLALPHYMHELADGRA

Western result: +

control morgue (383-491) A1045b (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: morgue (383-491)
CBI Antibody Core Code: A1045b
"Lot" Number: 1 Position: 20 (463-482)
% Identical Homology of Target to Mouse Protein: 45% (NP_064296.1| ubiquitin-conjugating enzyme E2D 2; ubiquitin conjugating enzyme 2e)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
IYEHERERFEQLVRAWTWKY

Antibody Name/Abbreviation: morgue (383-491)
CBI Antibody Core Code: A1045a
"Lot" Number: 1 Position: 60 (383-482)
% Identical Homology of Target to Mouse Protein: 51% (NP_997124.1| Similar to ubiquitin-conjugating enzyme E2D 2)
Molecular Weight of fusion protein: 19.5 KDa

Target sequence used to make this antibody:
GGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDVGI
DIFQQHNWSL

Antibody Name/Abbreviation: morgue (267-366)
CBI Antibody Core Code: A1046
"Lot" Number: 1 Position: 100 (267-366)
% Identical Homology of Target to Mouse Protein: 26% (NP_780556.2| sarcalumenin)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
KNTAQSMWKAYIKQRWPLFDSLADNPNWYRLYGALMSSCF
CRTCLIEMGGRGQDAQEADPQLGDREPGNVMRNNFLRGEA
NLLNSYESEGISAIPLDRQN

Sequence Name: morgue
Full name: Modifier of reaper-grim ubiquitously expressed
UniGene Number: N.A.
Accession Number: AAL83648
Source organism: fruit fly ( Drosophila melanogaster )
Full length size (aa): 491
NCBI information page:

Full length sequence:
MTSCVPAHQQKDQEQLLKELASSGDEMDDPDDPDQEHHQLVEPTFSFSNS
NTCWVCNGYYGPNFGEPLCGACHAFLYNAQRAEELLTELSDDEDSGNDEP
PFKDKQEDEETENDVDIMGFEDLEDPQPAAVPQHPNPQPPMEPQDQQPAQ
PVIDLPQPVPEAAAPRRESPERDFEHERAINPFLLPIKRPRATAPLALPH
YMHELADGRARVHEYNAASGSGASGSSRNIVNIIPVEVMLKIFAYLDDMS
LWMASEVCKQWHDIVGKNTAQSMWKAYIKQRWPLFDSLADNPNWYRLYGA
LMSSCFCRTCLIEMGGRGQDAQEADPQLGDREPGNVMRNNFLRGEANLLN
SYESEGISAIPLDRQNNYWQATILGPPGSPYEGGKFFLFIYFPERYPMTP
PTVRFLTKILHPNVSRHGDVGIDIFQQHNWSLALNVAKVLLSVQSLLTDP
YTEVCMEPELGYIYEHERERFEQLVRAWTWKYAMYELIAPR