Links to multiple antibodies on this page for Gr10a: Gr10a Gr10a Western result: + | | control
 | Gr10a A1105b (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: Gr10a CBI Antibody Core Code: A1105b "Lot" Number: 1 Position: 20 (1-20) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: MTSPDERKSFWERHEFKFYR
Antibody Name/Abbreviation: Gr10a CBI Antibody Core Code: A1105a "Lot" Number: 1 Position: 100 (100-199) % Identical Homology of Target to Mouse Protein: 45% (NP_683748.1| solute carrier family 8 (sodium/calcium exchanger), member 2) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: ATVIVTYVANTVHFEAINQRCTMQRTHLEFEFKNAPQEPK
RPFEFFMYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQV
RVHFAIYAFVLWNYTENMAD
| | Sequence Name: Gr10a Full name: CG32664-PA UniGene Number: N.A. Accession Number: P58950 Source organism: fruit fly ( Drosophila melanogaster ) Full length size (aa): 408 NCBI information page: Full length sequence: MTSPDERKSFWERHEFKFYRYGHVYALIYGQVVIDYVPQRALKRGVKVLL
IAYGHLFSMLLIVVLPGYFCYHFRTLTDTLDRRLQLLFYVSFTNTAIKYA
TVIVTYVANTVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPFEFFMYFKF
CLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVLWNYTENMADY
CYFINGSVLKYYRQFNLQLGSLRDEMDGLRPGGMLLHHCCELSDRLEELR
RRCREIHDLQRESFRMHQFQLIGLMLSTLINNLTNFYTLFHMLAKQSLEE
VSYPVVVGSVYATGFYIDTYIVALINEHIKLELEAVALTMRRFAEPREMD
ERLTREIEHLSLELLNYQPPMLCGLLHLDRRLVYLIAVTAFSYFITLVQF
DLYLRKKS
|