fruit fly ( Drosophila melanogaster )
dSmt3 (SUMO)

Western result: ++

GST GST-dSmt3 (SUMO) (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: dSmt3 (SUMO)
CBI Antibody Core Code: A0327
"Lot" Number: 1 Position: 90(1-90)
% Identical Homology of Target to Mouse Protein: 70% (NP_064313.1| SMT3 (supressor of mif two, 3) homolog 1; SMT3 (supressor of mif two, 3) homolog 1 (S. cerevisiae))
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMN
AYCDRAGLSMQVVRFRFDGQPINENDTPTSLEMEEGDTIE
VYQQQTGGAP

Sequence Name: dSmt3 (SUMO)
Full name:
UniGene Number: N.A.
Accession Number: NG_000743
Source organism: fruit fly ( Drosophila melanogaster )
Full length size (aa): 90
NCBI information page: click here

Full length sequence:
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSM
QVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAP