fruit fly ( Drosophila melanogaster )
TRF1

Western result: +

GST GST-TRF1 (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: TRF1
CBI Antibody Core Code: A0761
"Lot" Number: 1 Position: 100(67-166)
% Identical Homology of Target to Mouse Protein: 56% (NP_038712.1| TATA box binding protein)
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
KAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVI
CTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVA
TVDLRFPIRLENLNHVHGQF

Sequence Name: TRF1
Full name: TBP Related Factor 1
UniGene Number: Dm.3090
Accession Number: NM_057591
Source organism: fruit fly ( Drosophila melanogaster )
Full length size (aa): 224
NCBI information page: click here

Full length sequence:
MQFHFKVADAERDRDNVAATSNAAANPHAALQPQQPVALVEPKDAQHEIR
LQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIF
RTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDL
RFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTG
AKSRKDIMDCLEAISPILLSFRKT