Return to CBI Antibody Core Home Page
  Return to biothreat/emerging pathogens list
    Return to typhus (R strain) ( Rickettsia rickettsii ) list


typhus (R strain) ( Rickettsia rickettsii )
Rr. ompB


Antibody Name/Abbreviation: Rr. ompB
CBI Antibody Core Code: A1457

"Lot" Number: 1 Position: 85 (44-120)
% Identical Homology of Target to Mouse Protein: 23% (NP_035763.1| Tnf receptor-associated factor 5)
Molecular Weight of fusion protein: 22.47 KDa

Target sequence used to make this antibody:
FVVHKVTGRLSKTQSVLDGQVTPCINQPDRTTKTSYNLGL
SASIRSDAKMEYGIGYDAQISSKYTAHQGTLKVRVNF






Sequence Name: Rr. ompB
Full name: Rickettsia rickettsii outer membrane protein B
UniGene Number: N.A.
Accession Number: X163531
Source organism: typhus (R strain) ( Rickettsia rickettsii )
Full length size (aa): To be posted
NCBI information page: click here

Full length sequence:
GTTVANKQVNSKFSDRTDLIVGAKVAGSTMNITDLAVYPEVHAFVVHKVT
GRLSKTQSVLDGQVTPCINQPDRTTKTSYNLGLSASIRSDAKMEYGIGYD
AQISSKYTAHQGTLKVRVNF





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.