| Antibody Name/Abbreviation: Rr. ompB CBI Antibody Core Code: A1457 "Lot" Number: 1 Position: 85 (44-120) % Identical Homology of Target to Mouse Protein: 23% (NP_035763.1| Tnf receptor-associated factor 5) Molecular Weight of fusion protein: 22.47 KDa Target sequence used to make this antibody: FVVHKVTGRLSKTQSVLDGQVTPCINQPDRTTKTSYNLGL
SASIRSDAKMEYGIGYDAQISSKYTAHQGTLKVRVNF
| | Sequence Name: Rr. ompB Full name: Rickettsia rickettsii outer membrane protein B UniGene Number: N.A. Accession Number: X163531 Source organism: typhus (R strain) ( Rickettsia rickettsii ) Full length size (aa): To be posted NCBI information page: click here Full length sequence: GTTVANKQVNSKFSDRTDLIVGAKVAGSTMNITDLAVYPEVHAFVVHKVT
GRLSKTQSVLDGQVTPCINQPDRTTKTSYNLGLSASIRSDAKMEYGIGYD
AQISSKYTAHQGTLKVRVNF
|